Antibody For Cmv

Monoclonal antibody for SUR1 and SUR2B

SMC-432D Stressmarq 0.1mg 423.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Cytomegalovirus Antibody Laboratories manufactures the antibody for cmv reagents distributed by Genprice. The Antibody For Cmv reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact cytomegalovirus Antibody. Other Antibody products are available in stock. Specificity: Antibody Category: For Group: Cmv

True Blue

TargetMol Chemicals 5mg Ask for price
Description: True Blue

JBS True Blue

Jena Bioscience GmbH 300µl 11.84 EUR

JBS True Blue

MiTeGen 300 µl 16 EUR
Description: JBS True Blue

True Blue Chloride

Toronto Research Chemicals 100mg 11200 EUR
Description: 71431-30-6

True north Cryobox1.5/2mLNatural

Scientific Laboratory Supplies PK10 129.6 EUR

True Blue Diaceturate Salt

Toronto Research Chemicals 100mg 15000 EUR
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

Polysciences Europe GmbH 1mg Ask for price
Description: 108321-12-6

Cmv information

CMV antibody

20-CG70 Fitzgerald 1 mg 115 EUR
Description: Goat polyclonal CMV antibody

CMV antibody

MBS530513-02mg MyBiosource 0.2mg 345 EUR

CMV antibody

MBS530513-5x02mg MyBiosource 5x0.2mg 1405 EUR

CMV antibody

MBS530075-05mg MyBiosource 0.5mg 475 EUR

CMV antibody

MBS530075-5x05mg MyBiosource 5x0.5mg 1985 EUR

CMV antibody

MBS530085-1mg MyBiosource 1mg 515 EUR

CMV antibody

MBS530085-5x1mg MyBiosource 5x1mg 2170 EUR

CMV antibody

MBS530777-1mg MyBiosource 1mg 205 EUR

CMV antibody

MBS530777-5x1mg MyBiosource 5x1mg 785 EUR

CMV antibody

MBS530946-1mg MyBiosource 1mg 200 EUR

CMV antibody

MBS530946-5x1mg MyBiosource 5x1mg 740 EUR

CMV antibody

MBS531182-01mg MyBiosource 0.1mg 620 EUR

CMV antibody

MBS531182-5x01mg MyBiosource 5x0.1mg 2650 EUR

CMV antibody

MBS530003-1mg MyBiosource 1mg 200 EUR

CMV antibody

MBS530003-5x1mg MyBiosource 5x1mg 740 EUR

CMV antibody

MBS530203-02mg MyBiosource 0.2mg 390 EUR

CMV antibody

MBS530203-5x02mg MyBiosource 5x0.2mg 1610 EUR