Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D | Stressmarq | 0.1mg | 423.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Cytomegalovirus Antibody Laboratories manufactures the antibody for cmv reagents distributed by Genprice. The Antibody For Cmv reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact cytomegalovirus Antibody. Other Antibody products are available in stock. Specificity: Antibody Category: For Group: Cmv
True Blue |
||
TargetMol Chemicals | 5mg | Ask for price |
Description: True Blue |
||
JBS True Blue |
||
Jena Bioscience GmbH | 300µl | 11.84 EUR |
JBS True Blue |
||
MiTeGen | 300 µl | 16 EUR |
Description: JBS True Blue |
||
True Blue Chloride |
||
Toronto Research Chemicals | 100mg | 11200 EUR |
Description: 71431-30-6 |
||
True north Cryobox1.5/2mLNatural |
||
Scientific Laboratory Supplies | PK10 | 129.6 EUR |
True Blue Diaceturate Salt |
||
Toronto Research Chemicals | 100mg | 15000 EUR |
Description: 108321-12-6 |
||
True Blue (TB) Diaceturate Salt |
||
Polysciences Europe GmbH | 1mg | Ask for price |
Description: 108321-12-6 |
CMV antibody |
|||
20-CG70 | Fitzgerald | 1 mg | 115 EUR |
Description: Goat polyclonal CMV antibody |
|||
CMV antibody |
|||
MBS530513-02mg | MyBiosource | 0.2mg | 345 EUR |
CMV antibody |
|||
MBS530513-5x02mg | MyBiosource | 5x0.2mg | 1405 EUR |
CMV antibody |
|||
MBS530075-05mg | MyBiosource | 0.5mg | 475 EUR |
CMV antibody |
|||
MBS530075-5x05mg | MyBiosource | 5x0.5mg | 1985 EUR |
CMV antibody |
|||
MBS530085-1mg | MyBiosource | 1mg | 515 EUR |
CMV antibody |
|||
MBS530085-5x1mg | MyBiosource | 5x1mg | 2170 EUR |
CMV antibody |
|||
MBS530777-1mg | MyBiosource | 1mg | 205 EUR |
CMV antibody |
|||
MBS530777-5x1mg | MyBiosource | 5x1mg | 785 EUR |
CMV antibody |
|||
MBS530946-1mg | MyBiosource | 1mg | 200 EUR |
CMV antibody |
|||
MBS530946-5x1mg | MyBiosource | 5x1mg | 740 EUR |
CMV antibody |
|||
MBS531182-01mg | MyBiosource | 0.1mg | 620 EUR |
CMV antibody |
|||
MBS531182-5x01mg | MyBiosource | 5x0.1mg | 2650 EUR |
CMV antibody |
|||
MBS530003-1mg | MyBiosource | 1mg | 200 EUR |
CMV antibody |
|||
MBS530003-5x1mg | MyBiosource | 5x1mg | 740 EUR |
CMV antibody |
|||
MBS530203-02mg | MyBiosource | 0.2mg | 390 EUR |
CMV antibody |
|||
MBS530203-5x02mg | MyBiosource | 5x0.2mg | 1610 EUR |