Antibody For Cmv

Monoclonal antibody for SUR1 and SUR2B

SMC-432D Stressmarq 0.1mg 423.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Cytomegalovirus Antibody Laboratories manufactures the antibody for cmv reagents distributed by Genprice. The Antibody For Cmv reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact cytomegalovirus Antibody. Other Antibody products are available in stock. Specificity: Antibody Category: For Group: Cmv

JBS True Blue

MiTeGen 300 µl 16 EUR
Description: JBS True Blue

True Blue Chloride

Toronto Research Chemicals 100mg 11200 EUR
Description: 71431-30-6

True north Cryobox1.5/2mLNatural

Scientific Laboratory Supplies PK10 129.6 EUR

True Blue Diaceturate Salt

Toronto Research Chemicals 100mg 15000 EUR
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

Polysciences Europe GmbH 1mg Ask for price
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

Polysciences Europe GmbH 5mg Ask for price
Description: 108321-12-6

Goat True insulin ELISA kit

BlueGene 96T 700 EUR
Description: ELISA

Cmv information

CMV Antibody

abx022961-1ml Abbexa 1 ml 878.4 EUR

Antibody for CD9

SPC-1272D-A565 Stressmarq 0.1ml 432 EUR
Description: A polyclonal antibody for CD9 from Human | Mouse | Rat. The antibody is produced in rabbit after immunization with A synthesized peptide. The Antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:200), ICC/IF (1:200). This CD9 antibody is conjugated to ATTO 565.

Antibody for CD9

SPC-1272D-A633 Stressmarq 0.1ml 432 EUR
Description: A polyclonal antibody for CD9 from Human | Mouse | Rat. The antibody is produced in rabbit after immunization with A synthesized peptide. The Antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:200), ICC/IF (1:200). This CD9 antibody is conjugated to ATTO 633.

Antibody for CD9

SPC-1272D-A655 Stressmarq 0.1ml 432 EUR
Description: A polyclonal antibody for CD9 from Human | Mouse | Rat. The antibody is produced in rabbit after immunization with A synthesized peptide. The Antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:200), ICC/IF (1:200). This CD9 antibody is conjugated to ATTO 655.

Antibody for CD9

SPC-1272D-A680 Stressmarq 0.1ml 432 EUR
Description: A polyclonal antibody for CD9 from Human | Mouse | Rat. The antibody is produced in rabbit after immunization with A synthesized peptide. The Antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:200), ICC/IF (1:200). This CD9 antibody is conjugated to ATTO 680.

Antibody for CD9

SPC-1272D-A700 Stressmarq 0.1ml 432 EUR
Description: A polyclonal antibody for CD9 from Human | Mouse | Rat. The antibody is produced in rabbit after immunization with A synthesized peptide. The Antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:200), ICC/IF (1:200). This CD9 antibody is conjugated to ATTO 700.

Antibody for CD9

SPC-1272D-ALP Stressmarq 0.1ml 426 EUR
Description: A polyclonal antibody for CD9 from Human | Mouse | Rat. The antibody is produced in rabbit after immunization with A synthesized peptide. The Antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:200), ICC/IF (1:200). This CD9 antibody is conjugated to Alkaline Phosphatase.

Antibody for CD9

SPC-1272D-APC Stressmarq 0.1ml 430.8 EUR
Description: A polyclonal antibody for CD9 from Human | Mouse | Rat. The antibody is produced in rabbit after immunization with A synthesized peptide. The Antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:200), ICC/IF (1:200). This CD9 antibody is conjugated to APC .

Antibody for CD9

SPC-1272D-APCCY7 Stressmarq 0.1ml 518.4 EUR
Description: A polyclonal antibody for CD9 from Human | Mouse | Rat. The antibody is produced in rabbit after immunization with A synthesized peptide. The Antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:200), ICC/IF (1:200). This CD9 antibody is conjugated to APC/Cy7.

Antibody for CD9

SPC-1272D-DY350 Stressmarq 0.1ml 523.2 EUR
Description: A polyclonal antibody for CD9 from Human | Mouse | Rat. The antibody is produced in rabbit after immunization with A synthesized peptide. The Antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:200), ICC/IF (1:200). This CD9 antibody is conjugated to Dylight 350.

Antibody for CD9

SPC-1272D-DY405 Stressmarq 0.1ml 494.4 EUR
Description: A polyclonal antibody for CD9 from Human | Mouse | Rat. The antibody is produced in rabbit after immunization with A synthesized peptide. The Antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:200), ICC/IF (1:200). This CD9 antibody is conjugated to Dylight 405.

Antibody for CD9

SPC-1272D-DY488 Stressmarq 0.1ml 471.6 EUR
Description: A polyclonal antibody for CD9 from Human | Mouse | Rat. The antibody is produced in rabbit after immunization with A synthesized peptide. The Antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:200), ICC/IF (1:200). This CD9 antibody is conjugated to Dylight 488.

Antibody for CD9

SPC-1272D-DY594 Stressmarq 0.1ml 476.4 EUR
Description: A polyclonal antibody for CD9 from Human | Mouse | Rat. The antibody is produced in rabbit after immunization with A synthesized peptide. The Antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:200), ICC/IF (1:200). This CD9 antibody is conjugated to Dylight 594.

Antibody for CD9

SPC-1272D-DY633 Stressmarq 0.1ml 464.4 EUR
Description: A polyclonal antibody for CD9 from Human | Mouse | Rat. The antibody is produced in rabbit after immunization with A synthesized peptide. The Antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:200), ICC/IF (1:200). This CD9 antibody is conjugated to Dylight 633.

Antibody for CD9

SPC-1272D-HRP Stressmarq 0.1ml 418.8 EUR
Description: A polyclonal antibody for CD9 from Human | Mouse | Rat. The antibody is produced in rabbit after immunization with A synthesized peptide. The Antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:200), ICC/IF (1:200). This CD9 antibody is conjugated to HRP.

Antibody for CD9

SPC-1272D-P594 Stressmarq 0.1ml 440.4 EUR
Description: A polyclonal antibody for CD9 from Human | Mouse | Rat. The antibody is produced in rabbit after immunization with A synthesized peptide. The Antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:200), ICC/IF (1:200). This CD9 antibody is conjugated to PE/ATTO 594.

Antibody for CD9

SPC-1272D-PCP Stressmarq 0.1ml 430.8 EUR
Description: A polyclonal antibody for CD9 from Human | Mouse | Rat. The antibody is produced in rabbit after immunization with A synthesized peptide. The Antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:200), ICC/IF (1:200). This CD9 antibody is conjugated to PerCP.