Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D | Stressmarq | 0.1mg | 423.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Cytomegalovirus Antibody Laboratories manufactures the drus for cmv reagents distributed by Genprice. The Drus For Cmv reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact cytomegalovirus Antibody. Other Drus products are available in stock. Specificity: Drus Category: For Group: Cmv
True Blue |
||
TargetMol Chemicals | 5mg | Ask for price |
Description: True Blue |
||
JBS True Blue |
||
Jena Bioscience GmbH | 300µl | 11.84 EUR |
JBS True Blue |
||
MiTeGen | 300 µl | 16 EUR |
Description: JBS True Blue |
||
True Blue Chloride |
||
Toronto Research Chemicals | 100mg | 11200 EUR |
Description: 71431-30-6 |
||
True north Cryobox1.5/2mLNatural |
||
Scientific Laboratory Supplies | PK10 | 129.6 EUR |
True Blue Diaceturate Salt |
||
Toronto Research Chemicals | 100mg | 15000 EUR |
Description: 108321-12-6 |
||
True Blue (TB) Diaceturate Salt |
||
Polysciences Europe GmbH | 1mg | Ask for price |
Description: 108321-12-6 |
Eppendorf 1.5 To 2.0ml Tube Adaptors For T-60-11 Drum Rotor - PK6 |
|||
E5804731000 | Scientific Laboratory Supplies | PK6 | 265.95 EUR |
CMV |
|||
DAG169 | Creative Diagnostics | 1 ml | 635.25 EUR |
Description: Native |
|||
CMV UL83 (CMV, Cytomegalovirus, UL83) |
|||
MBS602599-025mg | MyBiosource | 0.25mg | 650 EUR |
CMV UL83 (CMV, Cytomegalovirus, UL83) |
|||
MBS602599-5x025mg | MyBiosource | 5x0.25mg | 2765 EUR |
ELISA kit for Human Anti-Cytomegalovirus IgM (Anti-CMV IgM) Kit |
|||
KTE63070-48T | Abbkine | 48T | 424.8 EUR |
Description: Quantitative sandwich ELISA for measuring Human Anti-Cytomegalovirus IgM (Anti-CMV IgM) Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
|||
ELISA kit for Human Anti-Cytomegalovirus IgM (Anti-CMV IgM) Kit |
|||
KTE63070-5platesof96wells | Abbkine | 5 plates of 96 wells | 2702.4 EUR |
Description: Quantitative sandwich ELISA for measuring Human Anti-Cytomegalovirus IgM (Anti-CMV IgM) Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
|||
ELISA kit for Human Anti-Cytomegalovirus IgM (Anti-CMV IgM) Kit |
|||
KTE63070-96T | Abbkine | 96T | 686.4 EUR |
Description: Quantitative sandwich ELISA for measuring Human Anti-Cytomegalovirus IgM (Anti-CMV IgM) Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
|||
Custom Testing of Samples for Mertansine (Free or conjugated) Drug by ELISA |
|||
220-250-CUX | Alpha Diagnostics | Custom | Ask for price |
Capillary micropipette Microcaps Drummond 0.5ulger) for pipettes 1 to 100 mL - PK100 |
|||
DD075071 | Scientific Laboratory Supplies | PK100 | 49.95 EUR |
CMV gB |
|||
cmv-211 | ProSpec Tany | 100µg | 165 EUR |
Description: Recombinant Cytomegalo Virus gB |
|||
pBK- CMV |
|||
PVT11024 | Lifescience Market | 2 ug | 361.2 EUR |
pRC- CMV |
|||
PVT11026 | Lifescience Market | 2 ug | 361.2 EUR |
pRc/CMV |
|||
PVTY00207 | Nova Lifetech | 2ug | 280 EUR |
CMV Pp28 |
|||
cmv-212 | ProSpec Tany | 100µg | 165 EUR |
Description: Recombinant Cytomegalo Virus Pp28 (UL99) |
|||
CMV Pp38 |
|||
cmv-213 | ProSpec Tany | 100µg | 165 EUR |
Description: Recombinant Cytomegalo Virus Pp38 (UL80a) |
|||
CMV Pp52 |
|||
cmv-214 | ProSpec Tany | 100µg | 165 EUR |
Description: Recombinant Cytomegalo Virus Pp52 (UL44) |
|||
CMV Pp65 |
|||
cmv-215 | ProSpec Tany | 100µg | 165 EUR |
Description: Recombinant Cytomegalo Virus Pp65(UL83) |