Drus For Cmv

Monoclonal antibody for SUR1 and SUR2B

SMC-432D Stressmarq 0.1mg 423.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Cytomegalovirus Antibody Laboratories manufactures the drus for cmv reagents distributed by Genprice. The Drus For Cmv reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact cytomegalovirus Antibody. Other Drus products are available in stock. Specificity: Drus Category: For Group: Cmv

True Blue

TargetMol Chemicals 5mg Ask for price
Description: True Blue

JBS True Blue

Jena Bioscience GmbH 300µl 11.84 EUR

JBS True Blue

MiTeGen 300 µl 16 EUR
Description: JBS True Blue

True Blue Chloride

Toronto Research Chemicals 100mg 11200 EUR
Description: 71431-30-6

True north Cryobox1.5/2mLNatural

Scientific Laboratory Supplies PK10 129.6 EUR

True Blue Diaceturate Salt

Toronto Research Chemicals 100mg 15000 EUR
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

Polysciences Europe GmbH 1mg Ask for price
Description: 108321-12-6

Cmv information

Eppendorf 1.5 To 2.0ml Tube Adaptors For T-60-11 Drum Rotor - PK6

E5804731000 Scientific Laboratory Supplies PK6 265.95 EUR

CMV

DAG169 Creative Diagnostics 1 ml 635.25 EUR
Description: Native

CMV UL83 (CMV, Cytomegalovirus, UL83)

MBS602599-025mg MyBiosource 0.25mg 650 EUR

CMV UL83 (CMV, Cytomegalovirus, UL83)

MBS602599-5x025mg MyBiosource 5x0.25mg 2765 EUR

ELISA kit for Human Anti-Cytomegalovirus IgM (Anti-CMV IgM)  Kit

KTE63070-48T Abbkine 48T 424.8 EUR
Description: Quantitative sandwich ELISA for measuring Human Anti-Cytomegalovirus IgM (Anti-CMV IgM)  Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Anti-Cytomegalovirus IgM (Anti-CMV IgM)  Kit

KTE63070-5platesof96wells Abbkine 5 plates of 96 wells 2702.4 EUR
Description: Quantitative sandwich ELISA for measuring Human Anti-Cytomegalovirus IgM (Anti-CMV IgM)  Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Anti-Cytomegalovirus IgM (Anti-CMV IgM)  Kit

KTE63070-96T Abbkine 96T 686.4 EUR
Description: Quantitative sandwich ELISA for measuring Human Anti-Cytomegalovirus IgM (Anti-CMV IgM)  Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Custom Testing of Samples for Mertansine (Free or conjugated) Drug by ELISA

220-250-CUX Alpha Diagnostics Custom Ask for price

Capillary micropipette Microcaps Drummond 0.5ulger) for pipettes 1 to 100 mL - PK100

DD075071 Scientific Laboratory Supplies PK100 49.95 EUR

CMV gB

cmv-211 ProSpec Tany 100µg 165 EUR
Description: Recombinant Cytomegalo Virus gB

pBK- CMV

PVT11024 Lifescience Market 2 ug 361.2 EUR

pRC- CMV

PVT11026 Lifescience Market 2 ug 361.2 EUR

pRc/CMV

PVTY00207 Nova Lifetech 2ug 280 EUR

CMV Pp28

cmv-212 ProSpec Tany 100µg 165 EUR
Description: Recombinant Cytomegalo Virus Pp28 (UL99)

CMV Pp38

cmv-213 ProSpec Tany 100µg 165 EUR
Description: Recombinant Cytomegalo Virus Pp38 (UL80a)

CMV Pp52

cmv-214 ProSpec Tany 100µg 165 EUR
Description: Recombinant Cytomegalo Virus Pp52 (UL44)

CMV Pp65

cmv-215 ProSpec Tany 100µg 165 EUR
Description: Recombinant Cytomegalo Virus Pp65(UL83)