Drus For Cmv

Monoclonal antibody for SUR1 and SUR2B

SMC-432D Stressmarq 0.1mg 423.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Cytomegalovirus Antibody Laboratories manufactures the drus for cmv reagents distributed by Genprice. The Drus For Cmv reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact cytomegalovirus Antibody. Other Drus products are available in stock. Specificity: Drus Category: For Group: Cmv

True north Cryobox 15mLBlue

Scientific Laboratory Supplies PK10 212.4 EUR

True north Cryobox 50mLNatural

Scientific Laboratory Supplies PK10 210 EUR

True north Cryobox 50mLBlue

Scientific Laboratory Supplies PK10 210 EUR

True north Cryobox1.5/2mLNatural

Scientific Laboratory Supplies PK10 162 EUR

True north Cryobox1.5/2.0mLGreen

Scientific Laboratory Supplies PK10 162 EUR

True north Cryobox 1.5/2.0mLBlue

Scientific Laboratory Supplies PK10 100.8 EUR

True north Cryobox 1.5/2.0mLBlue

Scientific Laboratory Supplies PK10 162 EUR

Cmv information

Loading step for Ensign for Rodwell autoclaves

AUT1350 Scientific Laboratory Supplies EACH 654 EUR

Discard System for Genesis for Rodwell autoclaves

AUT2000 Scientific Laboratory Supplies EACH 1030.8 EUR

Adaptor for flexible plates, accessory for AgileSealer?

APS-200-FP ACTGene each 421.2 EUR

CMV

DAG169 Creative Diagnostics 1 ml 832.8 EUR

FOR Filter for ChemFAST 06/12 Top/Elite

CAB1442 Scientific Laboratory Supplies EACH 1319.96 EUR

Falcon Cell Companion For For 12 Well Plate

353503 Scientific Laboratory Supplies PK50 183.6 EUR

Data cable for RS232 connection for Osmomat 3000

WAT4748 Scientific Laboratory Supplies EACH 188.01 EUR

Marking labels for microplates (on sheets for printing)

DD53080 Scientific Laboratory Supplies PK3120 154.8 EUR

Membrane Kit for 51302560

51340293 Scientific Laboratory Supplies EACH 261.6 EUR

Divider for 196 tubes (for boxes 136 x 136 mm)

DD39575 Scientific Laboratory Supplies EACH 8.4 EUR

Divider for 144 tubes (for boxes 136 x 136 mm)

DD39893 Scientific Laboratory Supplies EACH 4.8 EUR

Kinesis Handle for 7725

CHR2777 Scientific Laboratory Supplies EACH 201.6 EUR

Automatic FillDrain for Clean Steam for Rodwell autoclaves

AUT1351 Scientific Laboratory Supplies EACH 2328 EUR

Kinesis Fittings for 7060

CHR2703 Scientific Laboratory Supplies EACH 142.8 EUR

Calibration Kit For 2100N

WAT3662 Scientific Laboratory Supplies 1KIT 586.8 EUR

Dispenser for 7800 Earplugs

SAF6440 Scientific Laboratory Supplies PK500 109.67 EUR

Insert For Cap

1129818 Scientific Laboratory Supplies EACH 19.2 EUR