Testing For Cmv

Monoclonal antibody for SUR1 and SUR2B

SMC-432D Stressmarq 0.1mg 423.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Cytomegalovirus Antibody Laboratories manufactures the testing for cmv reagents distributed by Genprice. The Testing For Cmv reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact cytomegalovirus Antibody. Other Testing products are available in stock. Specificity: Testing Category: For Group: Cmv

True north Cryobox 15mLBlue

Scientific Laboratory Supplies PK10 212.4 EUR

True north Cryobox 50mLNatural

Scientific Laboratory Supplies PK10 210 EUR

True north Cryobox 50mLBlue

Scientific Laboratory Supplies PK10 210 EUR

True north Cryobox1.5/2mLNatural

Scientific Laboratory Supplies PK10 162 EUR

True north Cryobox1.5/2.0mLGreen

Scientific Laboratory Supplies PK10 162 EUR

True north Cryobox 1.5/2.0mLBlue

Scientific Laboratory Supplies PK10 100.8 EUR

True north Cryobox 1.5/2.0mLBlue

Scientific Laboratory Supplies PK10 162 EUR

Cmv information

Custom Testing of Samples for Xolair/Omalizumab by ELISA

200-410-CUX Alpha Diagnostics Custom Ask for price

Custom Testing of Samples for Daclizumab (Zenapax) by ELISA

210-300-CUX Alpha Diagnostics Custom Ask for price

Custom Testing of Samples for Eculizumab (Soliris) by ELISA

210-400-CUX Alpha Diagnostics Custom Ask for price

Custom Testing of samples for Rituximab/Rituxan ELISA Kit

200-210-CUX Alpha Diagnostics Custom 1365.6 EUR

Magnetic Loading/Testing Wand

M-CP-111-004 MiTeGen 1 UNIT 72 EUR
Description: Magnetic Loading/Testing Wand

Custom Testing of Samples for Basiliximab (Simulect) by ELISA

210-320-CUX Alpha Diagnostics Custom Ask for price

Custom Testing of Samples for Lucentis/Ranibizumab by ELISA

200-880-CUX Alpha Diagnostics Custom Ask for price

Custom Testing of Samples for Herceptin/Trastuzumab by ELISA

200-510-CUX Alpha Diagnostics Custom Ask for price

Phenanthroline 100ml Dairy Testing

DAI1138 Scientific Laboratory Supplies EACH 48 EUR

Materials Testing Oven M53 53L

INC1148 Scientific Laboratory Supplies EACH 8109.08 EUR

M720 720L Materials Testing Oven

INC1068 Scientific Laboratory Supplies EACH 15962.27 EUR

M240 240L Materials Testing Oven

INC1070 Scientific Laboratory Supplies EACH 11303.88 EUR

M400 400L Materials Testing Oven

INC1072 Scientific Laboratory Supplies EACH 13757.11 EUR

Materials Testing Oven M115 115L

INC1146 Scientific Laboratory Supplies EACH 9644.47 EUR

FP240 240L Materials Testing Oven

INC1062 Scientific Laboratory Supplies EACH 5994.01 EUR

FP400 400L Materials Testing Oven

INC1064 Scientific Laboratory Supplies EACH 7735.68 EUR

FP720 720L Materials Testing Oven

INC1066 Scientific Laboratory Supplies EACH 9711.05 EUR