Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D | Stressmarq | 0.1mg | 423.6 EUR |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Cytomegalovirus Antibody Laboratories manufactures the testing for cmv reagents distributed by Genprice. The Testing For Cmv reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact cytomegalovirus Antibody. Other Testing products are available in stock. Specificity: Testing Category: For Group: Cmv
True north Cryobox 15mLBlue |
||
Scientific Laboratory Supplies | PK10 | 212.4 EUR |
True north Cryobox 50mLNatural |
||
Scientific Laboratory Supplies | PK10 | 210 EUR |
True north Cryobox 50mLBlue |
||
Scientific Laboratory Supplies | PK10 | 210 EUR |
True north Cryobox1.5/2mLNatural |
||
Scientific Laboratory Supplies | PK10 | 162 EUR |
True north Cryobox1.5/2.0mLGreen |
||
Scientific Laboratory Supplies | PK10 | 162 EUR |
True north Cryobox 1.5/2.0mLBlue |
||
Scientific Laboratory Supplies | PK10 | 100.8 EUR |
True north Cryobox 1.5/2.0mLBlue |
||
Scientific Laboratory Supplies | PK10 | 162 EUR |
Custom Testing of Samples for Xolair/Omalizumab by ELISA |
|||
200-410-CUX | Alpha Diagnostics | Custom | Ask for price |
Custom Testing of Samples for Daclizumab (Zenapax) by ELISA |
|||
210-300-CUX | Alpha Diagnostics | Custom | Ask for price |
Custom Testing of Samples for Eculizumab (Soliris) by ELISA |
|||
210-400-CUX | Alpha Diagnostics | Custom | Ask for price |
Custom Testing of samples for Rituximab/Rituxan ELISA Kit |
|||
200-210-CUX | Alpha Diagnostics | Custom | 1365.6 EUR |
Magnetic Loading/Testing Wand |
|||
M-CP-111-004 | MiTeGen | 1 UNIT | 72 EUR |
Description: Magnetic Loading/Testing Wand |
|||
Custom Testing of Samples for Basiliximab (Simulect) by ELISA |
|||
210-320-CUX | Alpha Diagnostics | Custom | Ask for price |
Custom Testing of Samples for Lucentis/Ranibizumab by ELISA |
|||
200-880-CUX | Alpha Diagnostics | Custom | Ask for price |
Custom Testing of Samples for Herceptin/Trastuzumab by ELISA |
|||
200-510-CUX | Alpha Diagnostics | Custom | Ask for price |
Phenanthroline 100ml Dairy Testing |
|||
DAI1138 | Scientific Laboratory Supplies | EACH | 48 EUR |
Materials Testing Oven M53 53L |
|||
INC1148 | Scientific Laboratory Supplies | EACH | 8109.08 EUR |
M720 720L Materials Testing Oven |
|||
INC1068 | Scientific Laboratory Supplies | EACH | 15962.27 EUR |
M240 240L Materials Testing Oven |
|||
INC1070 | Scientific Laboratory Supplies | EACH | 11303.88 EUR |
M400 400L Materials Testing Oven |
|||
INC1072 | Scientific Laboratory Supplies | EACH | 13757.11 EUR |
Materials Testing Oven M115 115L |
|||
INC1146 | Scientific Laboratory Supplies | EACH | 9644.47 EUR |
FP240 240L Materials Testing Oven |
|||
INC1062 | Scientific Laboratory Supplies | EACH | 5994.01 EUR |
FP400 400L Materials Testing Oven |
|||
INC1064 | Scientific Laboratory Supplies | EACH | 7735.68 EUR |
FP720 720L Materials Testing Oven |
|||
INC1066 | Scientific Laboratory Supplies | EACH | 9711.05 EUR |