Monoclonal antibody for SUR1 and SUR2B |
|||
| SMC-432D | Stressmarq | 0.1mg | 423.6 EUR |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
|||
Cytomegalovirus Antibody Laboratories manufactures the testing for cmv reagents distributed by Genprice. The Testing For Cmv reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact cytomegalovirus Antibody. Other Testing products are available in stock. Specificity: Testing Category: For Group: Cmv
JBS True Blue |
||
| MiTeGen | 300 µl | 16 EUR |
|
Description: JBS True Blue |
||
True Blue Chloride |
||
| Toronto Research Chemicals | 100mg | 11200 EUR |
|
Description: 71431-30-6 |
||
True north Cryobox1.5/2mLNatural |
||
| Scientific Laboratory Supplies | PK10 | 129.6 EUR |
True Blue Diaceturate Salt |
||
| Toronto Research Chemicals | 100mg | 15000 EUR |
|
Description: 108321-12-6 |
||
True Blue (TB) Diaceturate Salt |
||
| Polysciences Europe GmbH | 1mg | Ask for price |
|
Description: 108321-12-6 |
||
True Blue (TB) Diaceturate Salt |
||
| Polysciences Europe GmbH | 5mg | Ask for price |
|
Description: 108321-12-6 |
||
Sheep True insulin ELISA kit |
||
| BlueGene | 96T | 700 EUR |
|
Description: ELISA |
||
Ammonia Testing Kit˜ |
|||
| WT042A-1NO | EWC Diagnostics | 1 unit | 37.41 EUR |
|
Description: Ammonia Testing Kit˜ |
|||
Sulphate Testing Kit |
|||
| WT043-1NO | EWC Diagnostics | 1 unit | 13.41 EUR |
|
Description: Sulphate Testing Kit |
|||
Sulphate Testing Kit |
|||
| WT043A-1NO | EWC Diagnostics | 1 unit | 8.52 EUR |
|
Description: Sulphate Testing Kit |
|||
Manganese Testing Kit |
|||
| WT045-1NO | EWC Diagnostics | 1 unit | 13.41 EUR |
|
Description: Manganese Testing Kit |
|||
Manganese Testing Kit |
|||
| WT045A-1NO | EWC Diagnostics | 1 unit | 7.09 EUR |
|
Description: Manganese Testing Kit |
|||
Oven with Cooling for Materials Testing MK56 60L - EACH |
|||
| INC1166 | Scientific Laboratory Supplies | EACH | 20713.02 EUR |
Oven with Cooling for Materials Testing MK115 115L - EACH |
|||
| INC1168 | Scientific Laboratory Supplies | EACH | 30194.12 EUR |
Oven with Cooling for Materials Testing MK240 228L - EACH |
|||
| INC1170 | Scientific Laboratory Supplies | EACH | 33663.43 EUR |
Oven with Cooling for Materials Testing MK720 734L - EACH |
|||
| INC1172 | Scientific Laboratory Supplies | EACH | 45770.75 EUR |
Oven with Cooling for Materials Testing KMF720 720L - EACH |
|||
| INC1126 | Scientific Laboratory Supplies | EACH | 32483.98 EUR |
Oven with Cooling for Materials Testing KMF115 102L - EACH |
|||
| INC1128 | Scientific Laboratory Supplies | EACH | 23657.96 EUR |
Oven with Cooling for Materials Testing MKT115 115L - EACH |
|||
| INC1132 | Scientific Laboratory Supplies | EACH | 40522.72 EUR |
Oven with Cooling for Materials Testing MKT240 228L - EACH |
|||
| INC1134 | Scientific Laboratory Supplies | EACH | 49707.13 EUR |
Oven with Cooling for Materials Testing MKT720 734L - EACH |
|||
| INC1136 | Scientific Laboratory Supplies | EACH | 65047.28 EUR |
Custom Testing of Samples for Humira/Adalimumab by ELISA |
|||
| 200-310-CUX | Alpha Diagnostics | Custom | Ask for price |
Custom Testing of Samples for Aflibercept/Eylea by ELISA |
|||
| 200-360-CUX | Alpha Diagnostics | Custom | Ask for price |
Custom Testing of Samples for Xolair/Omalizumab by ELISA |
|||
| 200-410-CUX | Alpha Diagnostics | Custom | Ask for price |