Testing For Cmv

Monoclonal antibody for SUR1 and SUR2B

SMC-432D Stressmarq 0.1mg 423.6 EUR
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Cytomegalovirus Antibody Laboratories manufactures the testing for cmv reagents distributed by Genprice. The Testing For Cmv reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact cytomegalovirus Antibody. Other Testing products are available in stock. Specificity: Testing Category: For Group: Cmv

True Blue

MyBiosource 5x5(mg 2705 EUR

JBS True Blue

Jena Bioscience GmbH 300µl 13.7 EUR

True Blue Chloride

Toronto Research Chemicals 100mg 11200 EUR
Description: 71431-30-6

JBS True Blue

MiTeGen 300 µl 16 EUR
Description: JBS True Blue

True north Cryobox1.5/2mLNatural

Scientific Laboratory Supplies PK10 129.6 EUR

True Blue Diaceturate Salt

Toronto Research Chemicals 100mg 15000 EUR
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

Polysciences Europe GmbH 1mg Ask for price
Description: 108321-12-6

Cmv information

Oven with Cooling for Materials Testing MKT720 734L - EACH

INC1136 Scientific Laboratory Supplies EACH 65047.28 EUR

Custom Testing of Samples for Humira/Adalimumab by ELISA

200-310-CUX Alpha Diagnostics Custom Ask for price

Custom Testing of Samples for Aflibercept/Eylea by ELISA

200-360-CUX Alpha Diagnostics Custom Ask for price

Custom Testing of Samples for Xolair/Omalizumab by ELISA

200-410-CUX Alpha Diagnostics Custom Ask for price

Soil Testing Kit

K054M-1KT EWC Diagnostics 1 unit 46.36 EUR
Description: Soil Testing Kit

Soil Testing Kit

K054S-1KT EWC Diagnostics 1 unit 37.84 EUR
Description: Soil Testing Kit

Zinc Testing Kit

WT044-1NO EWC Diagnostics 1 unit 32.68 EUR
Description: Zinc Testing Kit

Custom Testing of samples for Rituximab/Rituxan ELISA Kit

200-210-CUX Alpha Diagnostics Custom 1365.6 EUR

Custom Testing of Samples for Daclizumab (Zenapax) by ELISA

210-300-CUX Alpha Diagnostics Custom Ask for price

Custom Testing of Samples for Eculizumab (Soliris) by ELISA

210-400-CUX Alpha Diagnostics Custom Ask for price

Copper Testing Kit ˜

WT046-1NO EWC Diagnostics 1 unit 13.41 EUR
Description: Copper Testing Kit ˜

Copper Testing Kit ˜

WT046A-1NO EWC Diagnostics 1 unit 7.09 EUR
Description: Copper Testing Kit ˜

Custom Testing of Samples for Lucentis/Ranibizumab by ELISA

200-880-CUX Alpha Diagnostics Custom Ask for price

Custom Testing of Samples for Basiliximab (Simulect) by ELISA

210-320-CUX Alpha Diagnostics Custom Ask for price

Nitrite Testing Kit

WT007B-1NO EWC Diagnostics 1 unit 17.55 EUR
Description: Nitrite Testing Kit

Nitrite Testing Kit

WT007C-1NO EWC Diagnostics 1 unit 40.9 EUR
Description: Nitrite Testing Kit

Ammonia Testing Kit˜

WT042-1NO EWC Diagnostics 1 unit 100.28 EUR
Description: Ammonia Testing Kit˜